"action" : "rerender" LITHIUM.SearchAutoCompleteToggle({"containerSelector":"#searchautocompletetoggle_12e0cba708b33b","enableAutoCompleteSelector":".search-autocomplete-toggle-link","enableAutocompleteSuccessEvent":"LITHIUM:ajaxSuccess:enableAutoComplete","disableAutoCompleteSelector":".lia-autocomplete-toggle-off","disableAutocompleteSuccessEvent":"LITHIUM:ajaxSuccess:disableAutoComplete","autoCompleteSelector":".lia-autocomplete-input"}); { "context" : "envParam:quiltName", } { "event" : "editProductMessage", $(this).addClass('active') }, })(LITHIUM.jQuery); "closeImageIconURL" : "https://forum.vodafone.de/skins/images/3633B7E3512025038504892977369C15/responsive_peak/images/button_dialog_close.svg", }, }, { { } "includeRepliesModerationState" : "false", 18.12.2014, 00:22. Danach surfen Sie mit bis zu 5 kbit/s. ] Unter der Bezeichnung Vodafone Speedbucket vermarktet der Düsseldorfer Netzbetreiber Datenpakete mit zusätzlich 250, 750 oder 2000 Megabyte zum Preis von 4,99 Euro, 9,99 Euro und 14,99 Euro (4 Wochen Gültigkeit). Hat es dann geklappt?Alternativ kannst Du die SpeedGo-Funktion bis zum Ende des aktuellen Abrechnungszeitraums über die MeinVodafone App stoppen.Gruß,Matthias(Moderator), Bewertet hilfreiche Beiträge mit Likes und Sternen!Unaufgeforderte PNs werden nicht beantwortet - Bitte erstellt einen Thread. { }, element.removeClass('active'); Einnig er Vodafone með umboðsaðila víðsvegar um land. "action" : "rerender" Here you find everything you need Phones Cell phones and smartphones SIM Cards Phone SIM Cards Accessories Protections and chargers Mobile internet devices Pens and Hotspots Visiting Portugal Data and Phone SIM Card for Portugal visitors. More than 100 channels with a huge selection to suit all the family. }, var handleOpen = function(event) { "context" : "envParam:feedbackData", } var clickHandler = function(event) { "action" : "rerender" "initiatorBinding" : true, "actions" : [ "actions" : [ $('.menu-container').on('click','.community-node-menu-btn:not(.active)', {'selector' : '.css-node-menu'}, handleOpen); "event" : "AcceptSolutionAction", Tip us 888k 156k 74k 1.1m RSS Log in "messageViewOptions" : "1111110111111111111110111110100101011101" element.children('ul').slideDown(); LITHIUM.StarRating('#any_0_0', true, 2, 'LITHIUM:starRating'); "displayStyle" : "horizontal", Hodnocení vyhledávání. { "actions" : [ Du hast die Info-SMS gelöscht? { "event" : "markAsSpamWithoutRedirect", var handleClose = function(event) { "actions" : [ "actions" : [ LITHIUM.Dialog.options['219098908'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "componentId" : "forums.widget.message-view", "actions" : [ "context" : "envParam:quiltName,expandedQuiltName", { }, $('#custom-overall-notif-count').html(notifCount); }); ] "disableLinks" : "false", ] { Zu … return; Bist du sicher, dass du fortfahren möchtest? // Oops, not the right sequence, lets restart from the top. } "dialogKey" : "dialogKey" "action" : "rerender" } else { "showCountOnly" : "false", ] }, "initiatorDataMatcher" : "data-lia-kudos-id" LITHIUM.Dialog.options['424451256'] = {"contentContext":"valuesurveys.widget.survey-prompt-dialog","dialogOptions":{"minHeight":399,"draggable":false,"maxHeight":800,"resizable":false,"autoOpen":false,"width":610,"minWidth":610,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modal-simple lia-panel-dialog-modal-valuesurvey","position":["center","center"],"modal":true,"maxWidth":610,"ariaLabel":"Feedback for community"},"contentType":"ajax"}; "initiatorBinding" : true, ', 'ajax');","content":"Vorschläge deaktivieren"}],"prefixTriggerTextLength":3},"inputSelector":"#messageSearchField_12e0cba708b33b_1","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.tkbmessagesearchfield.messagesearchfield:autocomplete?t:ac=board-id/ArchivMeinVodafoneMeinKabelEMail/thread-id/20107&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); { "context" : "", LITHIUM.AjaxSupport.ComponentEvents.set({ Vodafone Group plc (/ ˈ v oʊ d ə f oʊ n /) is a British multinational telecommunications company. { count = 0; ] ] { "actions" : [ "context" : "envParam:quiltName,product,contextId,contextUrl", $('.menu-container').on('click','.community-user-menu-btn:not(.active)', {'selector' : '.css-user-menu'}, handleOpen); Unsere Experten stehen für Sie bereit. ] $(this).next().toggle(); "quiltName" : "ForumMessage", Sind 80% des inkludierten Datenvolumens eures Tarifs verbraucht, erhaltet ihr eine informelle SMS von Vodafone, die euch über euer versurftes Datenvolumen informiert. ] { { ] { { "event" : "MessagesWidgetCommentForm", "context" : "envParam:selectedMessage", "defaultAriaLabel" : "", ], .attr('aria-selected','true'); // Reset the conditions so that someone can do it all again. } window.location.replace('/t5/user/userloginpage'); ] "linkDisabled" : "false" "action" : "rerender" "event" : "MessagesWidgetEditAction", "parameters" : { "context" : "envParam:quiltName,expandedQuiltName", { "actions" : [ LITHIUM.Loader.runJsAttached(); "action" : "rerender" $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "event" : "MessagesWidgetEditAnswerForm", "action" : "rerender" "context" : "envParam:feedbackData", Samsung Galaxy S10 Plus. "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", }); { ;(function($) { { }, { // console.log(key); "actions" : [ } "parameters" : { "action" : "rerender" ] ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_14","feedbackSelector":".InfoMessage"}); ] "action" : "rerender" ","loaderSelector":"#lineardisplaymessageviewwrapper_1 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_12","feedbackSelector":".InfoMessage"}); GSMArena.com. window.location.replace('/t5/user/userloginpage'); { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "linkDisabled" : "false" "actions" : [ "event" : "MessagesWidgetCommentForm", { "entity" : "1322022", ] My Vodafone Manage your number in the app on your own. ;(function($) { Telephone Enjoy calls at 0 cents and call whoever you like. "context" : "", if ( neededkeys[count] == key ) { "actions" : [ { LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_1","menuItemsSelector":".lia-menu-dropdown-items"}}); Okay, 10 Euro waren jetzt zwar ein bisschen mehr als ich dachte, aber immer noch vertretbar. "componentId" : "kudos.widget.button", "action" : "rerender" "action" : "rerender" Vodafone Chat 655W. { watching = false; lithstudio: [], Dabei habe ich erst 11 % meines Datenvolumens verbraucht. LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper","componentSelector":"#lineardisplaymessageviewwrapper","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1320080,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "showCountOnly" : "false", "initiatorBinding" : true, }, "quiltName" : "ForumMessage", "action" : "pulsate" "kudosLinksDisabled" : "false", }); Hat es dann geklappt? Um weiter mit voller Geschwindigkeit zu surfen, antworten Sie einfach auf diese SMS mit dem Text "500". "action" : "rerender" "context" : "envParam:quiltName", "actions" : [ Die flexible Lösung für alle, die regelmäßig unterwegs oder auch zu Hause mit Ihrem Netbook, Notebook oder PC online gehen möchten. "useSubjectIcons" : "true", Řekněte nám, co vám na stránce nevyhovuje: Hledám něco jiného. "action" : "pulsate" { ] { } LITHIUM.StarRating('#any_2', false, 1, 'LITHIUM:starRating'); if(1 < 1){ "event" : "ProductMessageEdit", LITHIUM.PartialRenderProxy({"limuirsComponentRenderedEvent":"LITHIUM:limuirsComponentRendered","relayEvent":"LITHIUM:partialRenderProxyRelay","listenerEvent":"LITHIUM:partialRenderProxy"}); "message" : "1321763", }, }, ] if ( neededkeys[count] == key ) { "parameters" : { LITHIUM.Auth.KEEP_ALIVE_URL = '/t5/status/blankpage?keepalive'; //$('#vodafone-community-header .lia-search-input-wrapper').css('display','table-cell')} Jiný problém. } ;(function($) { Vodafone EF91. "actions" : [ } } } ] { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_9","feedbackSelector":".InfoMessage"}); ] }, "context" : "", } { { { "selector" : "#kudosButtonV2", }, "truncateBody" : "true", }, if ( neededkeys[count] == key ) { ] }, "eventActions" : [ "context" : "", { ] "actions" : [ "context" : "", 237.60 EUR. ], }); Pay monthly phones SIM only deals Home Broadband Top up Support Upgrades. { }, logmein: [76, 79, 71, 77, 69, 73, 78], "context" : "envParam:entity", } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_13","feedbackSelector":".InfoMessage"}); }); }, } LITHIUM.AjaxSupport.fromForm('#form_1', 'GiveRating', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "context" : "", "closeImageIconURL" : "https://forum.vodafone.de/skins/images/3633B7E3512025038504892977369C15/responsive_peak/images/button_dialog_close.svg", count = 0; "event" : "MessagesWidgetMessageEdit", Vodafone se stal hlavním partnerem online konference New Technology, kterou pořádá deník E15. })(LITHIUM.jQuery); "action" : "rerender" "context" : "", Bist du sicher, dass du fortfahren möchtest? } } count++; "action" : "rerender" 5 GB für 16,80 Euro pro Monat (netto). "action" : "rerender" Bietet euer Tarif monatlich 10 GB LTE, so erhaltet ihr bei Verbrauch von 8 GB eine Nachricht, auf die ihr dann reagieren könnt. } $(document).keydown(function(e) { ] "actions" : [ }, Zavřít. "action" : "rerender" "actions" : [ return; VODAFONE MOBILEINTERNET UPGRADE / DATEN-ZUSATZPAKET (NATIONAL) Normalerweise reicht Ihr gebuchtes mobiles Datenvolumen völlig aus: … "entity" : "1321763", { { }, "action" : "rerender" Vodafone GigaTV OTT. { "disableKudosForAnonUser" : "false", "actions" : [ LITHIUM.Auth.KEEP_ALIVE_TIME = 300000; gibt es schließlich auch jeweils 1 Top-Geräte mit 1 € Zuzahlung + Vertrag. "action" : "pulsate" resetMenu(); { Du bekommst eine Bestätigungs-Info. "context" : "", }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#pageInformation","feedbackSelector":".InfoMessage"}); { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_13","feedbackSelector":".InfoMessage"}); "}); "kudosable" : "true", Zusätzliches Datenvolumen liess sich hier bei Bedarf aber ebenfalls manuell buchen. })(LITHIUM.jQuery); "event" : "ProductAnswer", Du bekommst je nach Tarif … { "event" : "unapproveMessage", { { ] var notifCount = 0; "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { "useSimpleView" : "false", CookieManager = { } "event" : "ProductAnswer", "buttonDialogCloseAlt" : "Schließen", "action" : "rerender" $('.menu-container').on('click','.community-node-menu-btn.active', {'selector' : '.css-node-menu' }, handleClose); "componentId" : "kudos.widget.button", .attr('aria-hidden','false') // console.log('watching: ' + key); "action" : "rerender" { LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_0","componentSelector":"#lineardisplaymessageviewwrapper_0","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1321763,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten.